vodafone prepaid guthaben auszahlen


"context" : "envParam:quiltName,product,contextId,contextUrl", //if(height > 430) { { { } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, "actions" : [ "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", //$('#vodafone-community-header').css('display','block'); "event" : "MessagesWidgetAnswerForm", "context" : "envParam:feedbackData", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.ComponentEvents.set({ } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "entity" : "2087072", "event" : "MessagesWidgetEditCommentForm", } ] ] $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "rerender" } "initiatorBinding" : true, "initiatorBinding" : true, }, { { LITHIUM.Dialog.options['2060396634'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "selector" : "#messageview_2", } watching = true; "forceSearchRequestParameterForBlurbBuilder" : "false", { ] "action" : "rerender" Execute whatever should happen when entering the right sequence "action" : "rerender" }, "context" : "", "action" : "rerender" Nähere Infos dazu findest Du im Eilmeldungsboard. "}); { { }, "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ } Schicken Sie einen formlosen Brief per Einwurf-Einschreiben an die Adresse von Vodafone. "componentId" : "kudos.widget.button", { "actions" : [ "context" : "", element.find('ul').slideUp(); ], ] Vodafone online recharge made easy, recharge.oneindia.com is an easy & quick way to recharge your vodafone prepaid mobile through the powerful medium Internet. { { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", } { "useTruncatedSubject" : "true", .attr('aria-expanded','true'); "kudosLinksDisabled" : "false", }); "actions" : [ "event" : "approveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "actions" : [ ] "action" : "rerender" { { "defaultAriaLabel" : "", { "action" : "pulsate" ] "context" : "envParam:quiltName", { "activecastFullscreen" : false, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); { $(document).keydown(function(e) { "actions" : [ { return; LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "context" : "", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { { ] window.scrollTo(0,position_x.top - 150); } "action" : "rerender" // just for convenience, you need a login anyways... }); } ΠΡΟΣΘΗΚΗ ΣΤΟ ΚΑΛΑΘΙ. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] ] "accessibility" : false, "context" : "", LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "action" : "pulsate" { "includeRepliesModerationState" : "false", ] "eventActions" : [ "}); })(LITHIUM.jQuery); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "actions" : [ } "event" : "addThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" //} else { }, $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "", LITHIUM.Loader.runJsAttached(); "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" } }, { "context" : "", } LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ }, if ( key == neededkeys[0] ) { "context" : "lia-deleted-state", ;(function($) { "componentId" : "forums.widget.message-view", "actions" : [ "actions" : [ } notifCount = parseInt($(this).html()) + notifCount; "actions" : [ } lithstudio: [], "event" : "MessagesWidgetCommentForm", { "action" : "pulsate" So funktioniert die Aufladung von CallYa-Tarifen, Guthabenabfrage und Auszahlung. }, } ] "useSubjectIcons" : "true", } } ] "activecastFullscreen" : false, "kudosLinksDisabled" : "false", Nutzen Sie den Prepaid Tarif von Vodafone CallYa können Sie ganz leicht und auf verschiedenen Wegen Ihr aktuelles Guthaben abfragen. "actions" : [ "quiltName" : "ForumMessage", "actions" : [ "selector" : "#messageview_1", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "actions" : [ // console.log(key); '; ] LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "showCountOnly" : "false", { }, }, } LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { }, { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2087136 .lia-rating-control-passive', '#form_3'); ] { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "}); "context" : "lia-deleted-state", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "context" : "", lithstudio: [], "quiltName" : "ForumMessage", Main navigation. }, "accessibility" : false, "actions" : [ "initiatorBinding" : true, "actions" : [ { { "actions" : [ }, }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } return; Who has credit on a prepaid card, for example, Deutsche Telekom, Vodafone and O2, may withdraw this. { ] { }, "actions" : [ "event" : "removeThreadUserEmailSubscription", watching = false; Prepaid Guthaben auszahlen bei Vodafone. "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'iXas9x3gHcK5cIGw9ePAN7qxmdHGArtyAmUrwJ4iCGQ. ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "action" : "rerender" })(LITHIUM.jQuery); "componentId" : "forums.widget.message-view", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "action" : "addClassName" "eventActions" : [ } "displayStyle" : "horizontal", Prepaid Top-up code The top-up code/PIN will we delivered by E-mail, please follow the instructions in the E-mail to use the code/PIN. // Oops, not the right sequence, lets restart from the top. { { { }, var do_scroll = sessionStorage.is_scroll; { }, }, "action" : "rerender" // We made it! }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ;(function($){ } { ] }, "actions" : [ "useCountToKudo" : "false", "event" : "MessagesWidgetEditAnswerForm", } element.children('ul').slideDown(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" { "disallowZeroCount" : "false", "event" : "markAsSpamWithoutRedirect", } "actions" : [ } Dann lass es Dir auszahlen. if ( !watching ) { ', 'ajax'); "selector" : "#kudosButtonV2", "context" : "", "disallowZeroCount" : "false", "parameters" : { "truncateBody" : "true", "event" : "unapproveMessage", ] LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }); "event" : "AcceptSolutionAction", "context" : "", }, { } "entity" : "2087136", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" Deine Vodafone Prepaid Karte kannst Du einfach und bequem online aufladen - Direkt hier Betrag auswählen, Guthaben aufladen oder von Handy zu Handy übertragen. "actions" : [ "actions" : [ "action" : "rerender" var watching = false; $(this).next().toggle(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); } "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "useCountToKudo" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" } "eventActions" : [ "message" : "2087136", // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" "action" : "pulsate" "action" : "rerender" "componentId" : "forums.widget.message-view", ], "action" : "rerender" { "action" : "rerender" "action" : "pulsate" })(LITHIUM.jQuery); "context" : "envParam:selectedMessage", resetMenu(); } "actions" : [ }, "actions" : [ } { { "truncateBody" : "true", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "event" : "markAsSpamWithoutRedirect", ] { { "actions" : [ .attr('aria-expanded','false') LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_168de277410216","nodesModel":{"CallYa|forum-board":{"title":"Board-Suche: CallYa","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_168de277410216_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { { }); "event" : "removeMessageUserEmailSubscription", { } LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "disableLinks" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:entity", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/85887","ajaxErrorEventName":"LITHIUM:ajaxError","token":"wDoiM3S6n-kVIFcmjDGTNs39NH6UN_oOr9UyszcM55w. }, "disableKudosForAnonUser" : "false", { "action" : "rerender" //$('#lia-body').addClass('lia-window-scroll'); "event" : "addMessageUserEmailSubscription", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '-Ihg8DjHVcgHNuM6jdjJdug-7TkCCDyxgP-vteEVwtI. LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { }, "event" : "deleteMessage", ] } else { // We made it! "event" : "RevokeSolutionAction", // Set start to true only if the first key in the sequence is pressed } } "context" : "envParam:quiltName,expandedQuiltName", ] "action" : "rerender" "actions" : [ "context" : "", "context" : "", "actions" : [ "context" : "", $('.lia-button-wrapper-searchForm-action').removeClass('active'); "event" : "addThreadUserEmailSubscription", } } }, ] { }, "event" : "ProductAnswerComment", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] }, "buttonDialogCloseAlt" : "Schließen", LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "buttonDialogCloseAlt" : "Schließen", LITHIUM.Dialog.options['-1677365978'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, } lithadmin: [] { }); "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2087026,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } ;(function($) { "defaultAriaLabel" : "", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/85887","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tT9QWge-tZyNhTVZqsYhjFcwrnBanzV9s5Z9j1pOe5E. }); "action" : "rerender" }, { Ah okay. "action" : "rerender" "event" : "deleteMessage", }, ] LITHIUM.Dialog({ "context" : "", ] "displaySubject" : "true", { }, { "context" : "", "action" : "rerender" "actions" : [ "event" : "ProductAnswer", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.ComponentEvents.set({ } { } { } { { logmein: [76, 79, 71, 77, 69, 73, 78], "disableLinks" : "false", } { "event" : "editProductMessage", "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); { "action" : "rerender" ] } "kudosable" : "true", if ( neededkeys[count] == key ) { "action" : "rerender" { Hiermit beauftrage ich die Auszahlung meines Prepaid-Guthabens für die nachfolgende Prepaid-Mobilfunknummer. "disableLinks" : "false", }, }, "event" : "MessagesWidgetEditAction", ;(function($) { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { { "action" : "rerender" "action" : "rerender" ], { ] Habe jetzt jedoch den Tarif gewechselt und würde mir gerne dieses Restguthaben auszahlen lassen. "actions" : [ }, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087026}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087072}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087089}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087100}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2087136}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492835}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513162}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508080}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506436}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513941}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513873}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2513170}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512871}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512706}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2511715}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510796}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510469}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509918}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509847}}]);

Solvay Bernburg Produkte, Geocaching Mystery Lösungen, 400 Euro Fertig Gaming Pc, Restaurant Störmthaler See, Zugspitze Restaurant Panorama 2962 Speisekarte, Hängebauch Nach Kaiserschnitt, Italien Stürmer Wm 2014, Sallusts Thema 5 1-8 Stilmittel,